Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Novus Biologicals™ C11orf48 Protein 2

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

Manufacturer:  Novus Biologicals™ NBP181156PEP

Catalog No. NBP181156PE

Add to cart



A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C11ORF48. Source: E.coli Amino Acid Sequence: LVPGRSKEDGLWTRNSPGSSQHPESPRLPNPLWDRGKIGKVEGHQHIQDFSQKSHLPSIVVESSEVNEESGDLHLPHEELLLLTDGEEEDAEAFFQDQSE The LBHD1 Recombinant Protein Antigen is derived from E. coli. The LBHD1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-81156. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.



PBS and 1M Urea, pH 7.4.
Store at -20°C. Avoid freeze-thaw cycles.
Blocking/Neutralizing, Control
Safety and Handling

Safety and Handling

ShelfLife : 365

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

For Research Use Only