Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C11orf53 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen C11orf53
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15759420
View Documents
Novus Biologicals
NBP15759420UL
20 μL
Each for $152.22
Add to cart
 
NBP157594
View Documents
Novus Biologicals
NBP157594
100 μL
Each for $436.00
Add to cart
 
Description

Description

C11orf53 Polyclonal specifically detects C11orf53 in Human samples. It is validated for Western Blot.
Specifications

Specifications

C11orf53
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
chromosome 11 open reading frame 53, hypothetical protein LOC341032, MGC50104
C11ORF53
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
Q8IXP5
341032
Synthetic peptides corresponding to C11ORF53 The peptide sequence was selected from the middle region of C11ORF53. Peptide sequence SIAQHRGSSWGSSLAGAQSYSLHALEDLHHTPGYPTPPPYPFTPFMTVSN.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit