Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C12orf42 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP170431
Description
C12orf42 Polyclonal specifically detects C12orf42 in Human samples. It is validated for Western Blot.Specifications
C12orf42 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
C12ORF42 | |
Synthetic peptides corresponding to C12ORF42 The peptide sequence was selected from the N terminal of C12ORF42. Peptide sequence PRCSVSTVSFDEESYEEFRSSPAPSSETDEAPLIFTARGETEERARGAPK. | |
Affinity purified | |
RUO | |
374470 | |
Human | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
chromosome 12 open reading frame 42, FLJ25323, hypothetical protein LOC374470, MGC57409 | |
Rabbit | |
40 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction