Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C12orf42 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | C12orf42 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP170431
|
Novus Biologicals
NBP170431 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
C12orf42 Polyclonal specifically detects C12orf42 in Human samples. It is validated for Western Blot.Specifications
| C12orf42 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 374470 | |
| Synthetic peptides corresponding to C12ORF42 The peptide sequence was selected from the N terminal of C12ORF42. Peptide sequence PRCSVSTVSFDEESYEEFRSSPAPSSETDEAPLIFTARGETEERARGAPK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| chromosome 12 open reading frame 42, FLJ25323, hypothetical protein LOC374470, MGC57409 | |
| C12ORF42 | |
| IgG | |
| 40 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title