Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C12orf50 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | C12orf50 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP156725
|
Novus Biologicals
NBP156725 |
100 μL |
Each for $436.00
|
|
NBP15672520
|
Novus Biologicals
NBP15672520UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
C12orf50 Polyclonal specifically detects C12orf50 in Human samples. It is validated for Western Blot.Specifications
C12orf50 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
chromosome 12 open reading frame 50, FLJ35821, hypothetical protein LOC160419 | |
C12ORF50 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q8NA57 | |
160419 | |
Synthetic peptides corresponding to C12ORF50 The peptide sequence was selected from the N terminal of C12ORF50. Peptide sequence INGLFLPPSSNITLQKEIQEGIPLQSQSQEPLKPQENISRPIHHPLVLKT. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title