Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C14orf180 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00


Antigen C14orf180
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
View Documents
Novus Biologicals
20 μL
Each for $152.22
Add to cart
View Documents
Novus Biologicals
100 μL
Each for $436.00
Add to cart


C14orf180 Polyclonal specifically detects C14orf180 in Human samples. It is validated for Western Blot.


Synthetic peptides corresponding to C14ORF180 The peptide sequence was selected from the middle region of C14ORF180. Peptide sequence PPAVTVHYIADKNATATVRVPGRPRPHGGSLLLQLCVCVLLVLALGLYCG.
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
PBS and 2% Sucrose with 0.09% Sodium Azide
C14orf77, chromosome 14 open reading frame 180, chromosome 14 open reading frame 77, FLJ38594, NRAC, transmembrane protein C14orf180
Affinity Purified
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit