Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C14orf180 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | C14orf180 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15952220
|
Novus Biologicals
NBP15952220UL |
20 μL |
Each for $152.22
|
|
NBP159522
|
Novus Biologicals
NBP159522 |
100 μL |
Each for $436.00
|
|
Description
C14orf180 Polyclonal specifically detects C14orf180 in Human samples. It is validated for Western Blot.Specifications
C14orf180 | |
Polyclonal | |
Rabbit | |
Human | |
Q8N912 | |
400258 | |
Synthetic peptides corresponding to C14ORF180 The peptide sequence was selected from the middle region of C14ORF180. Peptide sequence PPAVTVHYIADKNATATVRVPGRPRPHGGSLLLQLCVCVLLVLALGLYCG. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
C14orf77, chromosome 14 open reading frame 180, chromosome 14 open reading frame 77, FLJ38594, NRAC, transmembrane protein C14orf180 | |
C14ORF180 | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title