C14orf180 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159680

Catalog No. NBP159680

Description

C14orf180 Polyclonal specifically detects C14orf180 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: C14orf180
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8N912
• Gene Symbols: C14ORF180
• Immunogen: Synthetic peptides corresponding to C14ORF180 The peptide sequence was selected from the N terminal of C14ORF180. Peptide sequence RTAAGAVSPDSRPETRRQTRKNEEAAWGPRVCRAEREDNRKCPPSILKRS.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 400258
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C14orf77, chromosome 14 open reading frame 180, chromosome 14 open reading frame 77, FLJ38594, NRAC, transmembrane protein C14orf180
• Host Species: Rabbit
• Molecular Weight of Antigen: 18 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.