Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C14orf180 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159680
Description
C14orf180 Polyclonal specifically detects C14orf180 in Human samples. It is validated for Western Blot.Specifications
C14orf180 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
C14orf77, chromosome 14 open reading frame 180, chromosome 14 open reading frame 77, FLJ38594, NRAC, transmembrane protein C14orf180 | |
Rabbit | |
18 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q8N912 | |
C14ORF180 | |
Synthetic peptides corresponding to C14ORF180 The peptide sequence was selected from the N terminal of C14ORF180. Peptide sequence RTAAGAVSPDSRPETRRQTRKNEEAAWGPRVCRAEREDNRKCPPSILKRS. | |
Affinity purified | |
RUO | |
400258 | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction