Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TEDC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | C14orf80 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP170436
|
Novus Biologicals
NBP170436 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
TEDC1 Polyclonal specifically detects TEDC1 in Human samples. It is validated for Western Blot.Specifications
C14orf80 | |
Polyclonal | |
Rabbit | |
chromosome 14 open reading frame 80 | |
Synthetic peptides corresponding to C14ORF80 The peptide sequence was selected from the n terminal of C14ORF80. Peptide sequence MLAQARVPLGDEMTVCQIHLYTRGCHSDQSLSHLSVTEAEMLRDPEGGQQ. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
283643 | |
IgG | |
28 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title