Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C15orf26 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$149.00 - $329.00

Specifications

Antigen C15orf26
Immunogen Synthetic peptides corresponding to C15ORF26 The peptide sequence was selected from the C terminal of C15ORF26. Peptide sequence LINHCHTNRGLAAHRHLFLSTYFGKEAEVVAHTYLDSHRVEKPRNHWMLV.
Host Species Rabbit
Primary or Secondary Primary
Monoclonal or Polyclonal Polyclonal
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP17043720 View Documents Novus BiologicalsSupplier Diversity Partner
NBP17043720UL
20ul Each for $149.00
Add to cart
 
NBP170437 View Documents Novus BiologicalsSupplier Diversity Partner
NBP170437
100 ul Each for $329.00
Add to cart
 
Description

Description

C15orf26 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

C15orf26
Rabbit
Polyclonal
Unconjugated
161502
Affinity Purified
Western Blot
RUO
Synthetic peptides corresponding to C15ORF26 The peptide sequence was selected from the C terminal of C15ORF26. Peptide sequence LINHCHTNRGLAAHRHLFLSTYFGKEAEVVAHTYLDSHRVEKPRNHWMLV.
Primary
IgG
chromosome 15 open reading frame 26, FLJ38615, hypothetical protein LOC161502
PBS and 2% Sucrose with 0.09% Sodium Azide
Immunogen affinity purified
Store at -20C. Avoid freeze-thaw cycles.
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit