Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C15orf26 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | C15orf26 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP170437
|
Novus Biologicals
NBP170437 |
100 μL |
Each of 1 for $436.00
|
|
Description
CFAP161 Polyclonal specifically detects CFAP161 in Human samples. It is validated for Western Blot.Specifications
C15orf26 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
161502 | |
IgG | |
Affinity Purified | |
34 kDa |
Western Blot | |
Unconjugated | |
RUO | |
chromosome 15 open reading frame 26, FLJ38615, hypothetical protein LOC161502 | |
Synthetic peptides corresponding to C15ORF26 The peptide sequence was selected from the C terminal of C15ORF26. Peptide sequence LINHCHTNRGLAAHRHLFLSTYFGKEAEVVAHTYLDSHRVEKPRNHWMLV. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title