Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Arpin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP191468
Description
Arpin Polyclonal specifically detects Arpin in Mouse samples. It is validated for Western Blot.Specifications
C15orf38 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
2610034B18Rik, RIKEN cDNA 2610034B18 gene | |
Rabbit | |
25 kDa | |
100 μL | |
Primary | |
This product recognizes Human, mouse. Predicted Homology Based On Immunogen Sequence: Rabbit: 86%; Zebrafish: 86%; Guinea pig: 79%. | |
Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_081696 | |
C15ORF38 | |
The specific Immunogen is proprietary information. Peptide sequence RYYVLYIQPSCIHRRKFDPKGNEIEPNFSATRKVNTGFLMSSYKVEAKGD. | |
Affinity purified | |
RUO | |
348110 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction