Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C15orf38 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus BiologicalsSupplier Diversity Partner NBP191468

 View more versions of this product

Catalog No. NBP191468


Add to cart

Description

Description

C15orf38 Polyclonal antibody specifically detects Antigen in Mouse samples. It is validated for Western Blotting.
Specifications

Specifications

C15orf38
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
C15ORF38
The specific Immunogen is proprietary information. Peptide sequence RYYVLYIQPSCIHRRKFDPKGNEIEPNFSATRKVNTGFLMSSYKVEAKGD.
25 kDa
100 ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
This product recognizes Human, mouse. Predicted Homology Based On Immunogen Sequence: Rabbit: 86%; Zebrafish: 86%; Guinea pig: 79%.
Mouse
Western Blot
Western Blot 1:1000
NP_081696
2610034B18Rik, RIKEN cDNA 2610034B18 gene
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
348110
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit