Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C16orf72 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP31071325UL

 View more versions of this product

Catalog No. NB126328


Add to cart

Description

Description

C16orf72 Polyclonal antibody specifically detects C16orf72 in Rat samples. It is validated for Western Blot
Specifications

Specifications

C16orf72
Unconjugated
PBS buffer, 2% sucrose
chromosome 16 open reading frame 72, FLJ41272, hypothetical protein LOC29035, PRO0149
The immunogen is a synthetic peptide directed towards the C-terminal region of Rat C16orf72 (NP_001100442). Peptide sequence LISFLCGKVPPPRNSRAPPRLTVVSPNRATSTETSSSVETDLQPFREAIA
25 μg
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Rat
Western Blot
Western Blot 1.0 ug/ml
Purified
Rabbit
Affinity purified
RUO
Primary
29035
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit