Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C17orf104 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | C17orf104 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP1704420
|
Novus Biologicals
NBP17044120UL |
20 μL |
Each for $152.22
|
|
NBP170441
|
Novus Biologicals
NBP170441 |
100 μL |
Each for $436.00
|
|
Description
Meiosis 1 Associated Protein Polyclonal specifically detects Meiosis 1 Associated Protein in Human samples. It is validated for Western Blot.Specifications
C17orf104 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
284071 | |
Synthetic peptides corresponding to FLJ35848(hypothetical protein FLJ35848) The peptide sequence was selected from the C terminal of FLJ35848. Peptide sequence LHIRLEECCEQWRALEKERKKTELALAKNYPGKKVSSTNNTPVPRLTSNP. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
chromosome 17 open reading frame 104, FLJ40428, hypothetical protein LOC284071, MGC43301 | |
C17orf104 | |
IgG | |
Affinity Purified | |
71 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title