Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C17orf39 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP15318420UL

 View more versions of this product

Catalog No. NBP15318420


Add to cart

Description

Description

C17orf39 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Western Blotting.
Specifications

Specifications

C17orf39
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Affinity Purified
GID4
Synthetic peptides corresponding to C17ORF39 The peptide sequence was selected from the C terminal of C17ORF39. Peptide sequence WDADEDVDRKHWGKFLAFYQYAKSFNSDDFDYEELKNGDYVFMRWKEQFL.
33 kDa
20ul
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1:100-1:2000
Q8IVV7
C17orf39, chromosome 17 open reading frame 39, GID complex subunit 4, VID24 homolog (S. cerevisiae), hypothetical protein LOC79018, MGC3048, VID24
Rabbit
IgG
Immunogen affinity purified
RUO
Primary
79018
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit