C17orf80 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159973

Catalog No. NBP159973

Description

C17orf80 Polyclonal specifically detects C17orf80 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: C17orf80
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9BSJ5
• Gene Symbols: C17ORF80
• Immunogen: Synthetic peptides corresponding to C17ORF80 The peptide sequence was selected from the N terminal of C17ORF80. Peptide sequence MSDNPPRMEVCPYCKKPFKRLKSHLPYCKMIGPTIPTDQKVYQSKPATLP.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Equine: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Cell migration-inducing gene 3 protein, chromosome 17 open reading frame 80, FLJ20721, HLC-8, HLC-8migration-inducing protein 3, Human lung cancer oncogene 8 protein, lung cancer-related protein 8, MIG3, SPEP1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55028
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.