Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C17orf80 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159973
Description
C17orf80 Polyclonal specifically detects C17orf80 in Human samples. It is validated for Western Blot.Specifications
C17orf80 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
Cell migration-inducing gene 3 protein, chromosome 17 open reading frame 80, FLJ20721, HLC-8, HLC-8migration-inducing protein 3, Human lung cancer oncogene 8 protein, lung cancer-related protein 8, MIG3, SPEP1 | |
Rabbit | |
Affinity purified | |
RUO | |
55028 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q9BSJ5 | |
C17ORF80 | |
Synthetic peptides corresponding to C17ORF80 The peptide sequence was selected from the N terminal of C17ORF80. Peptide sequence MSDNPPRMEVCPYCKKPFKRLKSHLPYCKMIGPTIPTDQKVYQSKPATLP. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Equine: 92%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction