Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C17orf80 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody



Antigen C17orf80
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
View Documents
Novus Biologicals
100 μL
Each of 1 for $436.00
Add to cart


C17orf80 Polyclonal specifically detects C17orf80 in Human samples. It is validated for Western Blot.


PBS and 2% Sucrose with 0.09% Sodium Azide
Cell migration-inducing gene 3 protein, chromosome 17 open reading frame 80, FLJ20721, HLC-8, HLC-8migration-inducing protein 3, Human lung cancer oncogene 8 protein, lung cancer-related protein 8, MIG3, SPEP1
Affinity Purified
Western Blot
Synthetic peptides corresponding to C17ORF80 The peptide sequence was selected from the N terminal of C17ORF80. Peptide sequence MSDNPPRMEVCPYCKKPFKRLKSHLPYCKMIGPTIPTDQKVYQSKPATLP.
Store at -20C. Avoid freeze-thaw cycles.
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit