Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C18orf25 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen C18orf25
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP157734
View Documents
Novus Biologicals
NBP157734
100 μL
Each for $436.00
N/A
NBP15773420
View Documents
Novus Biologicals
NBP15773420UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

C18orf25 Polyclonal specifically detects C18orf25 in Human samples. It is validated for Western Blot.
Specifications

Specifications

C18orf25
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
147339
Synthetic peptides corresponding to C18orf25 (chromosome 18 open reading frame 25) The peptide sequence was selected from the N terminal of C18orf25)(50ug). Peptide sequence MKMEEAVGKVEELIESEAPPKASEQETAKEEDGSVELESQVQKDGVADST.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
ARKadia-like 1, ARKL1, chromosome 18 open reading frame 25, hypothetical protein LOC147339, MGC12909, MGC87799
C18ORF25
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit