Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C18orf32 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen C18orf32
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP156827
View Documents
Novus Biologicals
NBP156827
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

C18orf32 Polyclonal specifically detects C18orf32 in Human samples. It is validated for Western Blot.
Specifications

Specifications

C18orf32
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
chromosome 18 open reading frame 32, FLJ23458, hypothetical protein LOC497661, Putative NF-kappa-B-activating protein 200, putative NFkB activating protein
C18ORF32
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
Q8TCD1
497661
Synthetic peptides corresponding to C18ORF32 The peptide sequence was selected from the middle region of C18ORF32. Peptide sequence PLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKK.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit