Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C18orf32 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | C18orf32 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156827
|
Novus Biologicals
NBP156827 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
C18orf32 Polyclonal specifically detects C18orf32 in Human samples. It is validated for Western Blot.Specifications
| C18orf32 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| chromosome 18 open reading frame 32, FLJ23458, hypothetical protein LOC497661, Putative NF-kappa-B-activating protein 200, putative NFkB activating protein | |
| C18ORF32 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8TCD1 | |
| 497661 | |
| Synthetic peptides corresponding to C18ORF32 The peptide sequence was selected from the middle region of C18ORF32. Peptide sequence PLVSPFVSRIWPKKAIQESNDTNKGKVNFKGADMNGLPTKGPTEICDKKK. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title