C19orf18 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP170444

Catalog No. NBP170444

Description

C19orf18 Polyclonal specifically detects C19orf18 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: C19orf18
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: chromosome 19 open reading frame 18, hypothetical protein LOC147685, MGC41906
• Host Species: Rabbit
• Molecular Weight of Antigen: 24 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8NEA5
• Gene Symbols: C19ORF18
• Immunogen: Synthetic peptides corresponding to C19orf18 (chromosome 19 open reading frame 18) The peptide sequence was selected from the N terminal of C19orf18. Peptide sequence NITGLPGSKRSQPPRNITKEPKVFFHKTQLPGIQGAASRSTAASPTNPMK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 147685
• Target Species: Human
• Isotype: IgG