C19orf47 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP170446

Catalog No. NBP170446

Description

C19orf47 Polyclonal specifically detects C19orf47 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: C19orf47
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: chromosome 19 open reading frame 47, DKFZp686P05129, FLJ36888, hypothetical protein LOC126526
• Host Species: Rabbit
• Molecular Weight of Antigen: 38 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Zebrafish 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: C19ORF47
• Immunogen: Synthetic peptides corresponding to C19ORF47 The peptide sequence was selected from the middle region of C19ORF47. Peptide sequence YVINMPKGTTPRTRKILEQQQAAKGLHRTSVFDRLGAETKADTTTGSKPT.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 126526
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.