Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C19orf47 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen C19orf47
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP17044620
View Documents
Novus Biologicals
NBP17044620UL
20 μL
Each for $152.22
Add to cart
 
NBP170446
View Documents
Novus Biologicals
NBP170446
100 μL
Each for $436.00
Add to cart
 
Description

Description

C19orf47 Polyclonal specifically detects C19orf47 in Human samples. It is validated for Western Blot.
Specifications

Specifications

C19orf47
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
126526
Synthetic peptides corresponding to C19ORF47 The peptide sequence was selected from the middle region of C19ORF47. Peptide sequence YVINMPKGTTPRTRKILEQQQAAKGLHRTSVFDRLGAETKADTTTGSKPT.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
chromosome 19 open reading frame 47, DKFZp686P05129, FLJ36888, hypothetical protein LOC126526
C19ORF47
IgG
Affinity Purified
38 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit