Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C19orf47 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | C19orf47 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17044620
|
Novus Biologicals
NBP17044620UL |
20 μL |
Each for $152.22
|
|
NBP170446
|
Novus Biologicals
NBP170446 |
100 μL |
Each for $436.00
|
|
Description
C19orf47 Polyclonal specifically detects C19orf47 in Human samples. It is validated for Western Blot.Specifications
| C19orf47 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 126526 | |
| Synthetic peptides corresponding to C19ORF47 The peptide sequence was selected from the middle region of C19ORF47. Peptide sequence YVINMPKGTTPRTRKILEQQQAAKGLHRTSVFDRLGAETKADTTTGSKPT. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| chromosome 19 open reading frame 47, DKFZp686P05129, FLJ36888, hypothetical protein LOC126526 | |
| C19ORF47 | |
| IgG | |
| Affinity Purified | |
| 38 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title