Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C19orf73 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | C19orf73 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179663
|
Novus Biologicals
NBP179663 |
100 μL |
Each of 1 for $436.00
|
|
Description
C19orf73 Polyclonal specifically detects C19orf73 in Human samples. It is validated for Western Blot.Specifications
C19orf73 | |
Polyclonal | |
Rabbit | |
Human | |
NP_060581 | |
55150 | |
Synthetic peptide directed towards the middle region of human FLJ10490. Peptide sequence VVRPAGFPRRTRLMVRSAPPTQRPPTGSGCVSGLWRKGLGLRPQTLLRVG. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
chromosome 19 open reading frame 73, FLJ10490, putative uncharacterized protein C19orf73 | |
C19ORF73 | |
IgG | |
Affinity Purified | |
14 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title