Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C1D Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | C1D |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179373
|
Novus Biologicals
NBP179373 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
C1D Polyclonal specifically detects C1D in Human samples. It is validated for Western Blot.Specifications
| C1D | |
| Polyclonal | |
| Rabbit | |
| NP_006324 | |
| 10438 | |
| Synthetic peptide directed towards the middle region of human C1DThe immunogen for this antibody is C1D. Peptide sequence LDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C1D DNA-binding protein, C1D nuclear receptor corepressor, C1D nuclear receptor co-repressor, hC1D, MGC12261, MGC14659, nuclear DNA-binding protein, nuclear nucleic acid-binding protein C1D, small unique nuclear receptor corepressor, small unique nuclear receptor co-repressor, SUN-CoR, SUNCORLRP1 | |
| C1D | |
| IgG |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title