Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C1orf105 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP310738100UL

 View more versions of this product

Catalog No. NB126377


Add to cart

Description

Description

C1orf105 Polyclonal specifically detects C1orf105 in Human samples. It is validated for Western Blot.
Specifications

Specifications

C1orf105
Unconjugated
PBS buffer, 2% sucrose
chromosome 1 open reading frame 105, hypothetical protein LOC92346, RP1-106H8.1
The immunogen is a synthetic peptide directed towards the C-terminal region of Human C1orf105 (NP_640333). Peptide sequence PEPFHDDIPTESIHYRLPILGPRTAVFHGLLTEAYKTLKERQRSSLPRKE
100 μg
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Polyclonal
Human
Western Blot
Western Blot 1.0 ug/ml
Purified
Rabbit
Affinity purified
RUO
Primary
92346
SDS
Documents
Product Certifications
Promotions

Promotions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit