Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Lymphocyte Expansion Molecule Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17045420UL
Description
Lymphocyte Expansion Molecule Polyclonal specifically detects Lymphocyte Expansion Molecule in Human samples. It is validated for Western Blot.Specifications
C1orf177 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
chromosome 1 open reading frame 177 | |
Rabbit | |
47 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
C1ORF177 | |
Synthetic peptides corresponding to C1ORF177 The peptide sequence was selected from the middle region of C1ORF177. Peptide sequence YSMQKKKPRELMNFKSFVEELNSHHNKKHGVFSKLPRNPKTPTERIYWAN. | |
Affinity Purified | |
RUO | |
163747 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction