Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Lymphocyte Expansion Molecule Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | C1orf177 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17045420
|
Novus Biologicals
NBP17045420UL |
20 μL |
Each for $204.00
|
|
|||||
|
NBP170454
|
Novus Biologicals
NBP170454 |
100 μL |
Each for $482.50
|
|
|||||
Description
Lymphocyte Expansion Molecule Polyclonal specifically detects Lymphocyte Expansion Molecule in Human samples. It is validated for Western Blot.Specifications
| C1orf177 | |
| Polyclonal | |
| Rabbit | |
| chromosome 1 open reading frame 177 | |
| C1ORF177 | |
| IgG | |
| 47 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 163747 | |
| Synthetic peptides corresponding to C1ORF177 The peptide sequence was selected from the middle region of C1ORF177. Peptide sequence YSMQKKKPRELMNFKSFVEELNSHHNKKHGVFSKLPRNPKTPTERIYWAN. | |
| Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title