Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C1orf51 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | C1orf51 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179508
|
Novus Biologicals
NBP179508 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
CIART Polyclonal specifically detects CIART in Human samples. It is validated for Western Blot.Specifications
| C1orf51 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| BC017397, chromosome 1 open reading frame 51, FLJ25889, hypothetical protein LOC148523 | |
| C1ORF51 | |
| IgG | |
| Affinity Purified | |
| 41 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_653298 | |
| 148523 | |
| Synthetic peptide directed towards the middle region of human C1orf51The immunogen for this antibody is C1orf51. Peptide sequence GRFERGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGTLLQVEGMLKTWF. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title