Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C1orf74 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | C1orf74 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP170456
|
Novus Biologicals
NBP170456 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
C1orf74 Polyclonal specifically detects C1orf74 in Human samples. It is validated for Western Blot.Specifications
| C1orf74 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 148304 | |
| Synthetic peptides corresponding to C1ORF74 The peptide sequence was selected from the N terminal of C1ORF74. Peptide sequence ICLHLAGEVLAVARGLKPAVLYDCNCAGASELQSYLEELKGLGFLTFGLH. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| chromosome 1 open reading frame 74 | |
| C1ORF74 | |
| IgG | |
| Affinity Purified | |
| 29 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title