Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C1qTNF1/CTRP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16229620UL
Description
C1qTNF1/CTRP1 Polyclonal specifically detects C1qTNF1/CTRP1 in Human samples. It is validated for Western Blot.Specifications
C1qTNF1/CTRP1 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q9BXJ1 | |
C1QTNF1 | |
Synthetic peptides corresponding to C1QTNF1(C1q and tumor necrosis factor related protein 1) The peptide sequence was selected from the N terminal of C1QTNF1. Peptide sequence YPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAGARGHTGPKGQKGS. | |
Affinity Purified | |
RUO | |
114897 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
C1q and tumor necrosis factor related protein 1, CTRP1G protein-coupled receptor-interacting protein, FLJ90694, G protein coupled receptor interacting protein, GIPcomplement C1q tumor necrosis factor-related protein 1, ZSIG37 | |
Rabbit | |
23 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title