C1qTNF1/CTRP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162296

Catalog No. NBP162296

Description

C1qTNF1/CTRP1 Polyclonal specifically detects C1qTNF1/CTRP1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: C1qTNF1/CTRP1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9BXJ1
• Gene Symbols: C1QTNF1
• Immunogen: Synthetic peptides corresponding to C1QTNF1(C1q and tumor necrosis factor related protein 1) The peptide sequence was selected from the N terminal of C1QTNF1. Peptide sequence YPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAGARGHTGPKGQKGS.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 114897
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C1q and tumor necrosis factor related protein 1, CTRP1G protein-coupled receptor-interacting protein, FLJ90694, G protein coupled receptor interacting protein, GIPcomplement C1q tumor necrosis factor-related protein 1, ZSIG37
• Host Species: Rabbit
• Molecular Weight of Antigen: 23 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.