Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C1qTNF1/CTRP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen C1qTNF1/CTRP1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP16229620
View Documents
Novus Biologicals
NBP16229620UL
20 μL
Each for $152.22
Add to cart
 
NBP162296
View Documents
Novus Biologicals
NBP162296
100 μL
Each for $436.00
Add to cart
 
Description

Description

C1qTNF1/CTRP1 Polyclonal specifically detects C1qTNF1/CTRP1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

C1qTNF1/CTRP1
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
C1q and tumor necrosis factor related protein 1, CTRP1G protein-coupled receptor-interacting protein, FLJ90694, G protein coupled receptor interacting protein, GIPcomplement C1q tumor necrosis factor-related protein 1, ZSIG37
C1QTNF1
IgG
Affinity Purified
23 kDa
Western Blot
Unconjugated
RUO
Q9BXJ1
114897
Synthetic peptides corresponding to C1QTNF1(C1q and tumor necrosis factor related protein 1) The peptide sequence was selected from the N terminal of C1QTNF1. Peptide sequence YPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAGARGHTGPKGQKGS.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit