Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C20orf111 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | C20orf111 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15686420
|
Novus Biologicals
NBP15686420UL |
20 μL |
Each for $152.22
|
|
NBP156864
|
Novus Biologicals
NBP156864 |
100 μL |
Each for $436.00
|
|
Description
OSER1 Polyclonal specifically detects OSER1 in Human samples. It is validated for Western Blot.Specifications
| C20orf111 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| chromosome 20 open reading frame 111, dJ1183I21.1, HSPC207, Osr1, oxidative stress responsive 1, Perit1, peroxide-inducible transcript 1 | |
| C20ORF111 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9NX31 | |
| 51526 | |
| Synthetic peptides corresponding to C20ORF111 The peptide sequence was selected from the N terminal of C20ORF111. Peptide sequence RGAVRTQRRRRSKSPVLHPPKFIHCSTIASSSSSQLKHKSQTDSPDGSSG. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title