Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C20orf111 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen C20orf111
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15686420
View Documents
Novus Biologicals
NBP15686420UL
20 μL
Each for $152.22
Add to cart
 
NBP156864
View Documents
Novus Biologicals
NBP156864
100 μL
Each for $436.00
Add to cart
 
Description

Description

OSER1 Polyclonal specifically detects OSER1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

C20orf111
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
chromosome 20 open reading frame 111, dJ1183I21.1, HSPC207, Osr1, oxidative stress responsive 1, Perit1, peroxide-inducible transcript 1
C20ORF111
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
Q9NX31
51526
Synthetic peptides corresponding to C20ORF111 The peptide sequence was selected from the N terminal of C20ORF111. Peptide sequence RGAVRTQRRRRSKSPVLHPPKFIHCSTIASSSSSQLKHKSQTDSPDGSSG.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit