Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C20orf132 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | C20orf132 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP157772
|
Novus Biologicals
NBP157772 |
100 μL |
Each of 1 for $436.00
|
|
Description
MROH8 Polyclonal specifically detects MROH8 in Human samples. It is validated for Western Blot.Specifications
C20orf132 | |
Polyclonal | |
Rabbit | |
Signal Transduction | |
C20orf131, chromosome 20 open reading frame 131, chromosome 20 open reading frame 132, dJ621N11.3, dJ621N11.4, DKFZp434N0426, FLJ36113, hypothetical protein LOC140699 | |
MROH8 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
140699 | |
Synthetic peptides corresponding to C20orf132 (chromosome 20 open reading frame 132) The peptide sequence was selected from the middle region of C20orf132)(50ug). Peptide sequence PHLENLDTIIKLPLRFQRLGHLVALMALLCGDPQEKVAEEAAEGIHSLLH. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title