Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C20orf160 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | C20orf160 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1704620
|
Novus Biologicals
NBP17046120UL |
20 μL |
Each for $152.22
|
|
NBP170461
|
Novus Biologicals
NBP170461 |
100 μL |
Each for $436.00
|
|
Description
CCM2L Polyclonal specifically detects CCM2L in Human samples. It is validated for Western Blot.Specifications
| C20orf160 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 140706 | |
| Synthetic peptides corresponding to C20ORF160 The peptide sequence was selected from the N terminal of C20ORF160. Peptide sequence LTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| chromosome 20 open reading frame 160, dJ310O13.5 | |
| CCM2L | |
| IgG | |
| Affinity Purified | |
| 47 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title