Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C20orf195 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | C20orf195 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP157700
|
Novus Biologicals
NBP157700 |
100 μL |
Each for $436.00
|
|
NBP15770020
|
Novus Biologicals
NBP15770020UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
FNDC11 Polyclonal specifically detects FNDC11 in Human samples. It is validated for Western Blot.Specifications
C20orf195 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
chromosome 20 open reading frame 195, hypothetical protein LOC79025, MGC5356 | |
C20ORF195 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q9BVV2 | |
79025 | |
Synthetic peptides corresponding to C20ORF195 The peptide sequence was selected from the N terminal of C20ORF195. Peptide sequence RMKKVGTAQTKIQLLLLGDLLEQLDHGRAELDALLRSPDPRPFLADWALV. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title