Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C20orf30 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159915
Description
TMEM230 Polyclonal specifically detects TMEM230 in Human samples. It is validated for Western Blot.Specifications
| C20orf30 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| Q96A57 | |
| TMEM230 | |
| Synthetic peptides corresponding to C20ORF30 The peptide sequence was selected from the C terminal of C20ORF30. Peptide sequence KGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD. | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| C20orf30, chromosome 20 open reading frame 30, dJ1116H23.2.1, HSPC274, hypothetical protein LOC29058, transmembrane protein 230 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 29058 | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title