Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C20orf30 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | C20orf30 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159915
|
Novus Biologicals
NBP159915 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
TMEM230 Polyclonal specifically detects TMEM230 in Human samples. It is validated for Western Blot.Specifications
| C20orf30 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| C20orf30, chromosome 20 open reading frame 30, dJ1116H23.2.1, HSPC274, hypothetical protein LOC29058, transmembrane protein 230 | |
| TMEM230 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q96A57 | |
| 29058 | |
| Synthetic peptides corresponding to C20ORF30 The peptide sequence was selected from the C terminal of C20ORF30. Peptide sequence KGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title