Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C20orf30 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen C20orf30
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP159915
View Documents
Novus Biologicals
NBP159915
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

TMEM230 Polyclonal specifically detects TMEM230 in Human samples. It is validated for Western Blot.
Specifications

Specifications

C20orf30
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
C20orf30, chromosome 20 open reading frame 30, dJ1116H23.2.1, HSPC274, hypothetical protein LOC29058, transmembrane protein 230
TMEM230
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
Q96A57
29058
Synthetic peptides corresponding to C20ORF30 The peptide sequence was selected from the C terminal of C20ORF30. Peptide sequence KGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit