GATD3A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180552

Catalog No. NBP180552

Description

GATD3A Polyclonal specifically detects GATD3A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: C21orf33
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: chromosome 21 open reading frame 33, D21S2048E, ES1, GT335, HES1, HES1KNP-Ia, human HES1 protein, homolog to E.coli and zebrafish ES1 protein, 10Protein GT335, Keio novel protein I, KNPH, KNPI, KNP-I, KNPImitochondrial, Protein KNP-I
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8209
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: NP_937798
• Gene Symbols: C21ORF33
• Immunogen: Synthetic peptide directed towards the N terminal of human C21orf33. Peptide sequence SRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Sheep: 92%; Xenopus: 75%.
• Target Species: Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Sheep, Zebrafish
• Form: Purified