Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C21orf33 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody



Antigen C21orf33
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Form Purified
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
View Documents
Novus Biologicals
100 μL
Each of 1 for $436.00
Add to cart


GATD3A Polyclonal specifically detects GATD3A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.


Synthetic peptide directed towards the N terminal of human C21orf33. Peptide sequence SRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDL.
Store at -20C. Avoid freeze-thaw cycles.
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
PBS and 2% Sucrose with 0.09% Sodium Azide
chromosome 21 open reading frame 33, D21S2048E, ES1, GT335, HES1, HES1KNP-Ia, human HES1 protein, homolog to E.coli and zebrafish ES1 protein, 10Protein GT335, Keio novel protein I, KNPH, KNPI, KNP-I, KNPImitochondrial, Protein KNP-I
Protein A purified
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit