Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C21orf58 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $627.50
Specifications
Antigen | C21orf58 |
---|---|
Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
C21orf58 Polyclonal specifically detects C21orf58 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
C21orf58 | |
Polyclonal | |
Rabbit | |
Human | |
AA82526610hypothetical protein LOC54058, chromosome 21 open reading frame 58, spliced ESTs Z25278 | |
C21orf58 | |
IgG | |
Affinity Purified |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
54058 | |
This antibody was developed against a recombinant protein corresponding to amino acids: TSLRKPWKLDRQKLPSPDSGHSLLCGWSPGGKARPAGNTGAWAPAEQFFPASNRTREGGGLWP | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?
Product Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title