Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C21orf58 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen C21orf58
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP170462
View Documents
Novus Biologicals
NBP170462
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

C21orf58 Polyclonal specifically detects C21orf58 in Human samples. It is validated for Western Blot.
Specifications

Specifications

C21orf58
Polyclonal
Rabbit
Human
P58505
54058
Synthetic peptides corresponding to C21orf58 (chromosome 21 open reading frame 58) The peptide sequence was selected from the N terminal of C21orf58. Peptide sequence MARSRLPATSLRKPWKLDRQKLPSPDSGHSLLCGWSPGGKARPAGNTGAW.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
AA82526610hypothetical protein LOC54058, chromosome 21 open reading frame 58, spliced ESTs Z25278
C21ORF58
IgG
Affinity Purified
35 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit