Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C21orf58 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | C21orf58 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP170462
|
Novus Biologicals
NBP170462 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
C21orf58 Polyclonal specifically detects C21orf58 in Human samples. It is validated for Western Blot.Specifications
| C21orf58 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| P58505 | |
| 54058 | |
| Synthetic peptides corresponding to C21orf58 (chromosome 21 open reading frame 58) The peptide sequence was selected from the N terminal of C21orf58. Peptide sequence MARSRLPATSLRKPWKLDRQKLPSPDSGHSLLCGWSPGGKARPAGNTGAW. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| AA82526610hypothetical protein LOC54058, chromosome 21 open reading frame 58, spliced ESTs Z25278 | |
| C21ORF58 | |
| IgG | |
| Affinity Purified | |
| 35 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title