Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C2orf27B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Specifications
| Antigen | C2orf27B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156812
|
Novus Biologicals
NBP156812 |
100 μL |
Each of 1 for $436.00
|
N/A | |||||
Description
C2orf27B Polyclonal specifically detects C2orf27B in Human samples. It is validated for Western Blot.Specifications
| C2orf27B | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q580R0-2 | |
| 408029 | |
| Synthetic peptides corresponding to MGC50273(MGC50273 protein) The peptide sequence was selected from the N terminal of MGC50273. Peptide sequence MFVRPESGEQGPETLAPASGAEIQRFPVPAVEPVPAPGADSPPGTALELE. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| chromosome 2 open reading frame 27B, hypothetical protein LOC408029, MGC50273 | |
| C2ORF27B | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title