Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C2orf27B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Specifications

Antigen C2orf27B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP156812
View Documents
Novus Biologicals
NBP156812
100 μL
Each of 1 for $436.00
N/A
Description

Description

C2orf27B Polyclonal specifically detects C2orf27B in Human samples. It is validated for Western Blot.
Specifications

Specifications

C2orf27B
Polyclonal
Rabbit
Human
Q580R0-2
408029
Synthetic peptides corresponding to MGC50273(MGC50273 protein) The peptide sequence was selected from the N terminal of MGC50273. Peptide sequence MFVRPESGEQGPETLAPASGAEIQRFPVPAVEPVPAPGADSPPGTALELE.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
chromosome 2 open reading frame 27B, hypothetical protein LOC408029, MGC50273
C2ORF27B
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit