Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C2orf42 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | C2orf42 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP170466
|
Novus Biologicals
NBP170466 |
100 μL |
Each for $436.00
|
|
NBP17046620
|
Novus Biologicals
NBP17046620UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
C2orf42 Polyclonal specifically detects C2orf42 in Human samples. It is validated for Western Blot.Specifications
| C2orf42 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 54980 | |
| Synthetic peptides corresponding to C2ORF42 The peptide sequence was selected from the N terminal of C2ORF42. Peptide sequence EPNSLRTKVPAFLSDLGKATLRGIRKCPRCGTYNGTRGLSCKNKTCGTIF. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| chromosome 2 open reading frame 42 | |
| C2ORF42 | |
| IgG | |
| Affinity Purified | |
| 63 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title