Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C2orf42 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen C2orf42
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP170466
View Documents
Novus Biologicals
NBP170466
100 μL
Each for $436.00
Add to cart
 
NBP17046620
View Documents
Novus Biologicals
NBP17046620UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

C2orf42 Polyclonal specifically detects C2orf42 in Human samples. It is validated for Western Blot.
Specifications

Specifications

C2orf42
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
54980
Synthetic peptides corresponding to C2ORF42 The peptide sequence was selected from the N terminal of C2ORF42. Peptide sequence EPNSLRTKVPAFLSDLGKATLRGIRKCPRCGTYNGTRGLSCKNKTCGTIF.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
chromosome 2 open reading frame 42
C2ORF42
IgG
Affinity Purified
63 kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit