Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C5orf4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$159.00 - $487.50
Specifications
| Antigen | C5orf4 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP1602520
![]() |
Novus Biologicals
NBP16012520UL |
20 μL |
Each for $159.00
|
|
|||||
NBP160125
![]() |
Novus Biologicals
NBP160125 |
100 μL |
Each for $487.50
|
|
|||||
Description
C5orf4 Polyclonal specifically detects C5orf4 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| C5orf4 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| 10826 | |
| Synthetic peptides corresponding to C5ORF4 The peptide sequence was selected from the N terminal of C5ORF4. Peptide sequence MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQ. | |
| Primary |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| chromosome 5 open reading frame 4, FLJ13758, hypothetical protein LOC10826 | |
| C5ORF4 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title