C6orf154 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156949

Catalog No. NBP156949

Description

LRRC73 Polyclonal specifically detects LRRC73 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: C6orf154
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q5JTD7
• Gene Symbols: LRRC73
• Immunogen: Synthetic peptides corresponding to C6ORF154 The peptide sequence was selected from the middle region of C6ORF154. Peptide sequence NLDYNPLGDHVAGMLAVAVASSRTLEVLDLEGTGLTNQSAQTLLDMVENY.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Equine: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C6orf154, chromosome 6 open reading frame 154, dJ337H4.2, FLJ44836, hypothetical protein LOC221424, leucine rich repeat containing 73, MGC131686
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 221424
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.