Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C6orf154 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | C6orf154 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156949
|
Novus Biologicals
NBP156949 |
100 μL |
Each for $436.00
|
|
NBP15694920
|
Novus Biologicals
NBP15694920UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
LRRC73 Polyclonal specifically detects LRRC73 in Human samples. It is validated for Western Blot.Specifications
| C6orf154 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| C6orf154, chromosome 6 open reading frame 154, dJ337H4.2, FLJ44836, hypothetical protein LOC221424, leucine rich repeat containing 73, MGC131686 | |
| LRRC73 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q5JTD7 | |
| 221424 | |
| Synthetic peptides corresponding to C6ORF154 The peptide sequence was selected from the middle region of C6ORF154. Peptide sequence NLDYNPLGDHVAGMLAVAVASSRTLEVLDLEGTGLTNQSAQTLLDMVENY. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title