Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C6orf64 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen C6orf64
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP160043
View Documents
Novus Biologicals
NBP160043
100 μL
Each for $436.00
Add to cart
 
NBP16004320
View Documents
Novus Biologicals
NBP16004320UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

SAYSD1 Polyclonal specifically detects SAYSD1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

C6orf64
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
C6orf64, chromosome 6 open reading frame 64, DKFZp434H012, FLJ11101, hypothetical protein LOC55776, SAYSVFN motif domain containing 1
SAYSD1
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
Q9NPB0
55776
Synthetic peptides corresponding to C6ORF64 The peptide sequence was selected from the C terminal of C6ORF64. Peptide sequence MYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLERELQLRPLAGR.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit