Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C6orf64 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | C6orf64 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP160043
|
Novus Biologicals
NBP160043 |
100 μL |
Each for $436.00
|
|
NBP16004320
|
Novus Biologicals
NBP16004320UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
SAYSD1 Polyclonal specifically detects SAYSD1 in Human samples. It is validated for Western Blot.Specifications
C6orf64 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
C6orf64, chromosome 6 open reading frame 64, DKFZp434H012, FLJ11101, hypothetical protein LOC55776, SAYSVFN motif domain containing 1 | |
SAYSD1 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q9NPB0 | |
55776 | |
Synthetic peptides corresponding to C6ORF64 The peptide sequence was selected from the C terminal of C6ORF64. Peptide sequence MYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLERELQLRPLAGR. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title