Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C7orf31 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | C7orf31 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP156351
|
Novus Biologicals
NBP156351 |
100 μL |
Each of 1 for $436.00
|
|
Description
C7orf31 Polyclonal specifically detects C7orf31 in Human samples. It is validated for Western Blot.Specifications
C7orf31 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
chromosome 7 open reading frame 31, hypothetical protein LOC136895 | |
C7ORF31 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
Q8N865 | |
136895 | |
Synthetic peptides corresponding to C7ORF31 The peptide sequence was selected from the N terminal of C7ORF31. Peptide sequence EVIHGRPYCCRELEGADILSNTFYSNELHNPLQTVTRPTASEDRYQELRE. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title