Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RBM48 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18047020UL
Description
RBM48 Polyclonal specifically detects RBM48 in Human samples. It is validated for Western Blot.Specifications
C7orf64 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_115496 | |
RBM48 | |
Synthetic peptide directed towards the C terminal of human DKFZP564O0523. Peptide sequence FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHKLKEVISSVPK. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
C7orf64, chromosome 7 open reading frame 64, DKFZp564O0523, DKFZp686D1651, HSPC304, hypothetical protein LOC84060, RNA binding motif protein 48 | |
Rabbit | |
Affinity Purified | |
RUO | |
84060 | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction